Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB2104288

Sigma-Aldrich

Anti-THPO antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-MGC163194, Anti-MGDF, Anti-MKCSF, Anti-ML, Anti-MPLLG

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

35 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NM_000460

N° accesso UniProt

P40225

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... THPO(7066)

Descrizione generale

Thrombopoietin (TPO) is a lineage specific growth factor, produced in the liver, kidney and skeletal muscle. It is an acidic glycoprotein. The gene encoding it is localized on human chromosome 3q27.1.

Immunogeno

Synthetic peptide directed towards the middle region of human THPO

Azioni biochim/fisiol

Thrombopoietin (TPO) stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the cellular proto-oncogene (c-mpl) receptor and acts as an important regulator of circulating platelets. High levels of TPO have been observed in patients with aplastic anemia.

Sequenza

Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Yoshio Takei
Handbook of Hormones: Comparative Endocrinology for Basic and Clinical Research (2015)
The molecular mechanisms that control thrombopoiesis.
Kaushansky K
The Journal of Clinical Investigation, 115(12), 3339-3347 (2005)
Sebastian Weiterer et al.
PloS one, 9(4), e94164-e94164 (2014-04-16)
Chromatin immunoprecipitation in combination with a genome-wide analysis via high-throughput sequencing is the state of the art method to gain genome-wide representation of histone modification or transcription factor binding profiles. However, chromatin immunoprecipitation analysis in the context of human experimental
Majed J Dasouki et al.
Blood, 122(20), 3440-3449 (2013-10-03)
We recently identified 2 siblings afflicted with idiopathic, autosomal recessive aplastic anemia. Whole-exome sequencing identified a novel homozygous missense mutation in thrombopoietin (THPO, c.112C>T) in both affected siblings. This mutation encodes an arginine to cysteine substitution at residue 38 or

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.