SAB2101136
Anti-IGF1R antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-CD221, Anti-IGFIR, Anti-Insulin-like growth factor 1 receptor, Anti-JTK13, Anti-MGC142170
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
71 kDa
Reattività contro le specie
pig, horse, sheep, bovine, dog, human
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunofluorescence: suitable
immunohistochemistry: suitable
western blot: suitable
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... IGF1R(3480)
Descrizione generale
Insulin-like growth factor 1 receptor (IGF1R), a transmembrane tyrosine kinase receptor, belongs to the insulin receptor family. It comprises juxtamembrane (JM) and transmembrane domains that harbor substrate binding sites. Structurally, IGF1R exists as a tetramer α2/β2 with the extracellular dimeric α subunits. The IGF1R gene is mapped to human chromosome 15q26.3.
Immunogeno
Synthetic peptide directed towards the middle region of human IGF1R
Azioni biochim/fisiol
Insulin-like growth factor 1 receptor (IGF1R) is prime for IGF-1 for its mitogenic and metabolic functionality. It binds to IGF1 and IGF2 and activates phosphatidylinositol 3?kinase (PI3K)/protein kinase B (AKT) and mitogen-activated protein kinase pathways. IGF1R plays a key role in growth, differentiation, cell metabolic events, and apoptosis. It also favors proliferation in the myelodysplastic syndrome (MDS) and may serve as a potential target to treat MDS. Mutations in the IGF1R gene are implicated in the pre- and postnatal growth retardation and microcephaly. High levels of IGF1R overexpression are observed in multiple myeloma, lung, breast, bladder and pancreatic tumors.
Sequenza
Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Andrey S Kuznetsov et al.
Biochimica et biophysica acta. Biomembranes, 1862(11), 183417-183417 (2020-07-28)
Despite the biological significance of insulin signaling, the molecular mechanisms of activation of the insulin receptor (IR) and other proteins from its family remain elusive. Current hypothesis on signal transduction suggests ligand-triggered structural changes in the extracellular domain followed by
Nilda Gonzalez-Roibon et al.
Urology, 83(6), 1444-1444 (2014-04-10)
To assess the insulin-like growth factor-1 receptor (IGF1R) expression in urothelial carcinoma (UC) and its prognostic role in relation to clinicopathologic parameters. A total of 100 cases of invasive UC were evaluated using tissue microarrays. Membranous IGF1R staining was evaluated
Anja Runge et al.
Cancer research, 74(15), 4157-4169 (2014-06-08)
The limited availability of experimental tumor models that faithfully mimic the progression of human tumors and their response to therapy remains a major bottleneck to the clinical translation and application of novel therapeutic principles. To address this challenge in hepatocellular
Three novel IGF1R mutations in microcephalic patients with prenatal and postnatal growth impairment.
Matias Juanes et al.
Clinical endocrinology, 82(5), 704-711 (2014-07-22)
IGF1R gene mutations have been associated with varying degrees of intrauterine and postnatal growth retardation, and microcephaly. To identify and characterize IGF1R gene variations in a cohort of 28 Argentinean children suspected of having IGF-1 insensitivity, who were selected on
Utku Donem Dilli et al.
Asian Pacific journal of cancer prevention : APJCP, 15(14), 5753-5757 (2014-08-02)
The purpose of this study is to determine whether the IGF1R expression has a prognostic role in non-small cell lung cancer. Forty-seven patients histopathologically diagnosed with small cell lung cancer upon bronchoscopic biopsy or resection materials were included in the
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.