Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB2100686

Sigma-Aldrich

Anti-EPAS1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Endothelial PAS domain protein 1, Anti-HIF2A, Anti-HLF, Anti-MOP2, Anti-PASD2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

90 kDa

Reattività contro le specie

human, rabbit, horse, bovine, rat, dog, guinea pig, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... EPAS1(2034)

Immunogeno

Synthetic peptide directed towards the middle region of human EPAS1

Azioni biochim/fisiol

EPAS1 is a transcription factor involved in the induction of oxygen regulated genes. EPAS1 binds to core DNA sequence 5′-[AG]CGTG-3′ within the hypoxia response element (HRE) of target gene promoters. EPAS1 regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. EPAS1 may also play a role in the formation of the endothelium that gives rise to the blood brain barrier. EPAS1 is a potent activator of the Tie-2 tyrosine kinase expression. The activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction of EPAS1 with redox regulatory protein APEX seems to activate CTAD.

Sequenza

Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.