Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

SAB1412182

Sigma-Aldrich

ANTI-SMAD4 antibody produced in mouse

clone 3D7, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

DPC4, JIP, MADH4, SMAD4

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3D7, monoclonal

Stato

buffered aqueous solution

PM

antigen 37.84 kDa

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SMAD4(4089)

Descrizione generale

The gene SMAD4 (mothers against decapentaplegic homolog 4), also known as DPC4 (deleted in pancreatic carcinoma), is mapped to human chromosome 18q21.1. The protein localizes in the cytoplasm and nucleus.

Immunogeno

SMAD4 (NP_005350, 56 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHD

Azioni biochim/fisiol

Upon TGFβ (transforming growth factor β) activation, SMAD (mothers against decapentaplegic homolog) proteins are responsible for transcription activation in the nucleus. SMAD4 is a crucial protein of TGFβ signaling. It promotes association of SMAD2/4 to DNA and helps SMAD1/2 in transcription stimulation. Mutations in SMAD4 are linked with juvenile polyposis syndrome, hereditary haemorrhagic telangiectasia and Myhre syndrome. In renal cell carcinoma, it activates forkhead box protein H1 and thereby inhibits the progression of the carcinoma. SMAD4 is considered as a tumor suppressor protein.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

3-Phosphoinositide-dependent PDK1 negatively regulates transforming growth factor-beta-induced signaling in a kinase-dependent manner through physical interaction with Smad proteins.
Seong HA
The Journal of Biological Chemistry, 282, 12272-12289 (2007)
A restricted spectrum of mutations in the SMAD4 tumor-suppressor gene underlies Myhre syndrome.
Caputo V
American Journal of Human Genetics, 90, 161-169 (2012)
Smad4 suppresses the progression of renal cell carcinoma via the activation of forkhead box protein H1.
Liu Y
Molecular Medicine Reports, 11, 2717-2722 (2015)
A combined syndrome of juvenile polyposis and hereditary haemorrhagic telangiectasia associated with mutations in MADH4 (SMAD4).
Gallione CJ
Lancet, 363, 852-859 (2004)
Mutations in DPC4 (SMAD4) cause juvenile polyposis syndrome, but only account for a minority of cases.
Houlston R
Human Molecular Genetics, 7, 1907-1912 (1998)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.