SAB1408098

Anti-FBXW9 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Fbw9, MGC10870
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~14.3 kDa
• Reattività contro le specie: human
• tecniche: western blot: 1 μg/mL
• N° accesso NCBI: NM_032301.1
• N° accesso UniProt: Q5XUX1
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FBXW9(84261)

Descrizione

Descrizione generale

Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM

Immunogeno

FBXW9 (ENSP00000254324, 1 a.a. ~ 135 a.a) full-length human protein.

Sequence
MTGTSSQAARTTPWWWWTAEPTASCSVCSWTPTCSACPTRNPSSGLVTTRACCTSSPTATAASSLSGPLMWATAFPSLGSSTPWEPCTPHPLTRPSGCTCPQTHQGPFAPEGMTMGSIGSVLRATWWWPALETCR

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable