Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

SAB1404007

Sigma-Aldrich

Monoclonal Anti-KIT antibody produced in mouse

clone 6G12, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

C-Kit, CD117, PBT, SCFR

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

6G12, monoclonal

Stato

buffered aqueous solution

PM

antigen ~37 kDa

Reattività contro le specie

human

tecniche

capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2bκ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KIT(3815)

Descrizione generale

This gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogeno

KIT (NP_000213, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Francesco Ciccia et al.
Rheumatology (Oxford, England), 53(7), 1313-1320 (2014-03-08)
The aim of this study was to evaluate the role of rituximab (RTX) in modulating the expression of the IL-17/IL-23 pathway in the salivary glands (SGs) of patients with primary SS (pSS). Consecutive SG biopsies were obtained from 15 patients
Marc P Pusztaszeri et al.
Cancer cytopathology, 122(8), 596-603 (2014-06-13)
c-KIT/CD117 down-regulation has been described in papillary thyroid carcinoma (PTC). In this study, the authors investigated CD117 as an ancillary immunocytochemical test for PTC in fine-needle aspiration biopsy (FNAB). The expression of CD117 was assessed in cytologic samples of histologically
Cláudia M Salgado et al.
Pediatric and developmental pathology : the official journal of the Society for Pediatric Pathology and the Paediatric Pathology Society, 17(3), 198-203 (2014-04-01)
Nevocytes (NC) and mastocytes (MC) have different progenitors but share stem cell factor as regulator/activator of NC and for differentiation/proliferation of MC. Both cell types express stem cell factor receptor CD117. We hypothesize that large/giant congenital melanocytic nevi (L/GCMN) may
Suchandra Chowdhury et al.
Glycoconjugate journal, 31(6-7), 523-535 (2014-10-07)
Childhood acute lymphoblastic leukaemia (ALL) originates from mutations in haematopoietic progenitor cells (HPCs). For high-risk patients, treated with intensified post-remission chemotherapy, haematopoietic stem cell (HSC) transplantation is considered. Autologous HSC transplantation needs improvisation till date. Previous studies established enhanced disease-associated
J Marius Munneke et al.
Blood, 124(5), 812-821 (2014-05-24)
Allogeneic hematopoietic stem cell transplantation (HSCT) is widely used to treat hematopoietic cell disorders but is often complicated by graft-versus-host disease (GVHD), which causes severe epithelial damage. Here we have investigated longitudinally the effects of induction chemotherapy, conditioning radiochemotherapy, and

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.