Passa al contenuto
Merck
Tutte le immagini(3)

Key Documents

SAB1403527

Sigma-Aldrich

Monoclonal Anti-PARP1, (N-terminal) antibody produced in mouse

clone 2C7, purified immunoglobulin, buffered aqueous solution

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2C7, monoclonal

Forma fisica

buffered aqueous solution

PM

antigen ~37 kDa

Reattività contro le specie

human

tecniche

capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PARP1(142)

Descrizione generale

Poly (ADP-ribose) polymerase 1 (PARP1) is a nuclear protein which possesses three functional domains. It belongs to the PARP family and the gene encoding it is localized on human chromosome 1q42.

Immunogeno

PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD

Azioni biochim/fisiol

Poly (ADP-ribose) polymerase 1 (PARP1) has a role in DNA repair and acts as a facilitator of homologous recombination. It controls transcription by modulating chromatin structure and altering DNA methylation patterns. The protein functions as a co-regulator of transcription factors and associates with chromatin insulators. PARP1 also has an important role in protection of the cardiovascular system.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

PARP inhibition: PARP1 and beyond
Michele Rouleau
Nature Reviews. Cancer (2010)
PARP-1 protein expression in glioblastoma multiforme
A, Galia
European Journal of Histochemistry (2012)
Trapping of PARP1 and PARP2 by Clinical PARP Inhibitors.
Murai J
Cancer Research (2012)
Shaohua Chen et al.
Cancer letters, 348(1-2), 20-28 (2014-02-19)
In this study, we explored the antitumor activities of the PARP inhibitor AZD2281 (Olaparib) and the pan-Bcl-2 inhibitor GX15-070 (Obatoclax) in six pancreatic cancer cell lines. While both agents were able to cause growth arrest and limited apoptosis, the combination
François Lamoureux et al.
European urology, 66(1), 145-155 (2014-01-15)
Although prostate cancer responds initially to androgen ablation therapies, progression to castration-resistant prostate cancer (CRPC) frequently occurs. Heat shock protein (Hsp) 90 inhibition is a rational therapeutic strategy for CRPC that targets key proteins such as androgen receptor (AR) and

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.