Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

SAB1402973

Sigma-Aldrich

Monoclonal Anti-PXDN antibody produced in mouse

clone 2C11, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

D2S448, D2S448E, KIAA0230, MG50, PRG2, PXN, VPO

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2C11, monoclonal

Stato

buffered aqueous solution

PM

antigen ~38.21 kDa

Reattività contro le specie

human

tecniche

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2bκ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PXDN(7837)

Descrizione generale

Drosophila peroxidasin is an extracellular matrix-associated peroxidase (Horikoshi et al., 1999 [PubMed 10441517]). It is expressed exclusively in hemocytes derived from head mesoderm at a very early stage of differentiation. Peroxidasin exists as a homotrimer with a unique hybrid structure that combines an enzymatically functional peroxidase domain with motifs that are typically found in extracellular matrix-associated proteins. It is a secreted protein that contains a secretory recognition sequence at its N terminus. Peroxidasin catalyzes hydrogen peroxide-driven radioiodination, oxidations, and the formation of dityrosine in vitro. It is also thought to function in extracellular matrix consolidation, phagocytosis, and defense.[supplied by OMIM] Peroxidasin (PXDN) is a multidomain, glycosylated, homotrimeric peroxidase. It is expressed in the endoplasmic reticulum and secreted into the extracellular matrix. The 1479-amino acid protein belongs to the peroxidase-cyclooxygenase superfamily. It possesses a catalytic peroxidase domain (POX), a leucine-rich repeat domain (LRR), four C-like immunoglobulin domains (Ig) at the amino-terminal and a carboxy-terminal von Willebrand factor type C module (VWC). The gene encoding PXDN has 23 exons and is localized on human chromosome 2p25.3.

Immunogeno

PXDN (XP_056455, 1452 a.a. ~ 1561 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK

Azioni biochim/fisiol

Peroxidasin (PXDN) releases hypobromous acid, which is involved in collagen IV reinforcement. The protein stabilizes the basement membrane by enhancing the covalent crosslinks in the collagen IV network. Mutations in the gene encoding PXDN have been linked to microphthalmia and anterior segment dysgenesis.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Jodi Dougan et al.
International journal of molecular sciences, 20(12) (2019-06-27)
Peroxidasin (PXDN), a human homolog of Drosophila PXDN, belongs to the family of heme peroxidases and has been found to promote oxidative stress in cardiovascular tissue, however, its role in prostate cancer has not been previously elucidated. We hypothesized that
Microduplications Disrupting the MYT1L Gene (2p25.3) are Associated with Schizophrenia
Yohan Lee
Psychiatric Genetics (2012)
Selene Colon et al.
American journal of physiology. Renal physiology, 316(2), F360-F371 (2018-12-20)
Renal fibrosis is the pathological hallmark of chronic kidney disease (CKD) and manifests as glomerulosclerosis and tubulointerstitial fibrosis. Reactive oxygen species contribute significantly to renal inflammation and fibrosis, but most research has focused on superoxide and hydrogen peroxide (H2O2). The
Novel mutations in PXDN cause microphthalmia and anterior segment dysgenesis.
Choi A
European Journal of Human Genetics (2015)
Pre-steady-state Kinetics Reveal the Substrate Specificity and Mechanism of Halide Oxidation of Truncated Human Peroxidasin 1.
Paumann-Page M
The Journal of Biological Chemistry (2017)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.