SAB1402749

Monoclonal Anti-CYB5R3 antibody produced in mouse

clone 2A9, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: B5R, DIA1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2A9, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~36.67 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso NCBI: BC004821
• N° accesso UniProt: P00387
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CYB5R3(1727)

Descrizione

Descrizione generale

This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. These two forms are resulted from alternative splicing of the gene. Mutations in this gene cause methemoglobinemias. (provided by RefSeq)

Immunogeno

CYB5R3 (AAH04821.1, 157 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable