SAB1401873
Anti-INHBE antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Sinonimo/i:
MGC4638
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.43
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
purified immunoglobulin
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
Reattività contro le specie
mouse, human
tecniche
immunoprecipitation (IP): suitable
western blot: 1 μg/mL
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
dry ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... INHBE(83729)
Categorie correlate
Descrizione generale
Inhibin subunit beta E (INHBE) is a dimeric protein, which is majorly expressed in human liver. The gene is located on human chromosome 12q13.3.
Immunogeno
INHBE (NP_113667.1, 1 a.a. ~ 350 a.a) full-length human protein.
Sequence
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Sequence
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Azioni biochim/fisiol
Inhibin subunit beta E (INHBE) may be associated with carcinogenesis. Differential expression of INHBE in human endometrial tissue plays an important role in endometrial maturation and blastocyst implantation. The protein is a hepatokine linked to hepatic gene expression. It is associated with insulin resistance and body mass index in humans. The protein expression in liver is stimulated by insulin. It is involved in glucose metabolism.
Caratteristiche e vantaggi
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Stato fisico
Solution in phosphate buffered saline, pH 7.4
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Ci dispiace, ma al momento non ci sono COA disponibili online per questo prodotto.
Se ti serve aiuto, non esitare a contattarci Servizio Clienti
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Evidence of inhibin/activin subunit betaC and betaE synthesis in normal human endometrial tissue
Mylonas L and Br
Reproductive Biology and Endocrinology, 8(1), 143-143 (2010)
Inhibin betaE (INHBE) is a possible insulin resistance-associated hepatokine identified by comprehensive gene expression analysis in human liver biopsy samples
Sugiyama M, et al.
PLoS ONE, 13(3), e0194798-e0194798 (2018)
An insight into the phylogenetic history of HOX linked gene families in vertebrates
Abbasi AA, et al.
BMC Evolutionary Biology, 7(1), 239-239 (2007)
cDNA cloning and expression of human activin betaE subunit
Hashimoto O, et al.
Molecular and Cellular Endocrinology, 194(1-2), 117-122 (2002)
Florian Bergauer et al.
Journal of molecular histology, 40(5-6), 353-359 (2009-12-25)
Inhibins are dimeric glycoproteins, composed of an alpha-subunit and one of two possible beta-subunits (betaA or betaB), with substantial roles in human reproduction and in endocrine-responsive tumours. Recently a novel beta subunit named betaE was described, although it is still
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.