Passa al contenuto
Merck
Tutte le immagini(3)

Key Documents

SAB1401724

Sigma-Aldrich

Monoclonal Anti-SSH1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

FLJ38102, KIAA1298, SSH-1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(3)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2F9, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

capture ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso NCBI

NM_018984

N° accesso UniProt

Q8WYL5

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SSH1(54434)

Descrizione generale

The ADF (actin-depolymerizing factor)/cofilin family (see MIM 601442) is composed of stimulus-responsive mediators of actin dynamics. ADF/cofilin proteins are inactivated by kinases such as LIM domain kinase-1 (LIMK1; MIM 601329). The SSH family appears to play a role in actin dynamics by reactivating ADF/cofilin proteins in vivo (Niwa et al., 2002 [PubMed 11832213]).[supplied by OMIM

Immunogeno

SSH1 (NP_061857.2, 752 a.a. ~ 849 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPAS

Applicazioni

Monoclonal Anti-SSH1 antibody produced in mouse is suitable for capture ELISA and western blot assay.

Azioni biochim/fisiol

SSH1 (Slingshot protein phosphatase 1) is mainly involved in the actin filament organization. During cytokinesis, it reactivates ADF (actin-depolymerizing factor)/cofilin, which plays a major role in actin filament dynamics and cell migration. Apart from cofilin reactivation, it also dephosphorylates P-cofilin in vitro and in vivo. Overexpression of SSH1 has been reported in pancreatic cancer (PC) cells, which indicates its role in tumor cell migration via SSH1L/cofilin-1 signal pathway.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Ryusuke Niwa et al.
Cell, 108(2), 233-246 (2002-02-08)
The ADF (actin-depolymerizing factor)/cofilin family is a stimulus-responsive mediator of actin dynamics. In contrast to the mechanisms of inactivation of ADF/cofilin by kinases such as LIM-kinase 1 (LIMK1), much less is known about its reactivation through dephosphorylation. Here we report
Noriko Kaji et al.
The Journal of biological chemistry, 278(35), 33450-33455 (2003-06-17)
During cytokinesis the actomyosin-based contractile ring is formed at the equator, constricted, and then disassembled prior to cell abscission. Cofilin stimulates actin filament disassembly and is implicated in the regulation of contractile ring dynamics. However, little is known about the
Yufeng Wang et al.
Cancer letters, 360(2), 171-176 (2015-02-17)
Slingshot-1L (SSH1L), a cofilin-phosphatase, plays a role in actin dynamics and cell migration by reactivating cofilin-1. However, the expression of SSH1L in malignant diseases is poorly understood. The overexpression of SSH1L in cancerous tissue compared to the matched surrounding non-cancerous

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.