I17001
Interferon-γ human
IFN-gamma, recombinant, expressed in HEK 293 cells, suitable for cell culture, endotoxin tested
Sinonimo/i:
IFN-γ
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Prodotti consigliati
Ricombinante
expressed in HEK 293 cells
Livello qualitativo
Saggio
≥98% (SDS-PAGE)
Stato
lyophilized powder
Potenza
≤0.250 ng/mL In Viral Resistance Assay ED50
PM
16 kDa (glycosylated)
tecniche
cell culture | mammalian: suitable
Compatibilità
endotoxin tested
Temperatura di conservazione
−20°C
Cerchi prodotti simili? Visita Guida al confronto tra prodotti
Descrizione generale
Interferon-γ (IFN-γ) is a pleotropic cytokine, encoded by the gene mapped to human chromosome 12q15. It is a non-covalent homodimer with two identical 17kDa polypeptide chains. It belongs to the type II class of interferons.
Recombinant human Interferon-γ (IFN-γ) is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 16 kDa. This protein is manufactured in human cells using an all-human production system, with full chemically defined ingredients and with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture. The bioactivity of IFN-γ expressed in human 293 cells is significantly higher compared to bacterially expressed IFN-γ.
Applicazioni
Interferon-γ human has been used in cytometric bead array to measure the levels of interferon-γ in the sample.
It has also been used for cytokine treatment of human islets to evaluate the activation of hypoxia inducible factor 1 α (HIF1α) targets, in vitro.
Azioni biochim/fisiol
IFN-γ is a dimerized soluble cytokine that is the only member of the type II class of interferons.
Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses. IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells. This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity. In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.
Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses. IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells. This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity. In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.
Sequenza
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Stato fisico
Supplied as a lyophilized powder containing phosphate buffered saline.
Risultati analitici
The biological activity of recombinant human IFN-γ was tested in culture in a viral resistance assay. The ED50 is defined as the effective concentration of IFN-γ that allows 50% cell growth in an antiviral cell based bioassay.
Codice della classe di stoccaggio
11 - Combustible Solids
Classe di pericolosità dell'acqua (WGK)
WGK 2
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
I clienti hanno visto anche
Clinical use of interferon?γ.
Miller C H, et al.
Annals of the New York Academy of Sciences, 1182(1), 69-79 (2009)
The IFNγ receptor: a paradigm for cytokine receptor signaling.
Bach E A, et al.
Annual Review of Immunology, 15(1), 563-591 (1997)
Class II cytokine receptors and their ligands: key antiviral and inflammatory modulators.
Renauld J C.
Nature Reviews: Immunology, 3(8), 667-667 (2003)
Expression and reconstitution of a biologically active mouse interferon gamma receptor in hamster cells. Chromosomal location of an accessory factor.
Hibino Y, et al.
The Journal of Biological Chemistry, 266(11), 6948-6951 (1991)
David A Constant et al.
ImmunoHorizons, 6(7), 416-429 (2022-07-06)
The three types of IFN have roles in antimicrobial immunity and inflammation that must be properly balanced to maintain tissue homeostasis. For example, IFNs are elevated in the context of inflammatory bowel disease and may synergize with inflammatory cytokines such
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.