Passa al contenuto
Merck
Tutte le immagini(5)

Documenti fondamentali

HPA041702

Sigma-Aldrich

Anti-PLA2G15 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-Gxvpla2, Anti-Llpl, Anti-Lypla3, Anti-Phospholipase a2, group xv

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.43

Origine biologica

rabbit

Livello qualitativo

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

tecniche

immunohistochemistry: 1:50-1:200

Sequenza immunogenica

GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PLA2G15(23659)

Descrizione generale

The phospholipase A2 group XV (PLA2G15) gene is mapped to human chromosome 16q22.1. The encoded protein with a molecular weight of 45kDa is assumed to be associated with high-density lipoprotein. PLA2G15 is expressed in exosomes.

Immunogeno

phospholipase A2, group XV recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Azioni biochim/fisiol

Phospholipase A2 group XV (PLA2G15) codes for lysophospholipase enzyme, which catalyzes regulation of the multifunctional lysophospholipids. In addition, the encoded protein also hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. Deficiency of PLA2G15 might lead to phospholipidosis.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST82156

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

The phospholipase A2 superfamily and its group numbering system.
Schaloske RH
Biochimica et Biophysica Acta, 1761(11), 1246-1259 (2006)
Identification and validation of an eight-gene expression signature for predicting high Fuhrman grade renal cell carcinoma.
Wan F
International Journal of Cancer. Journal International Du Cancer, 140(5), 1199-1208 (2017)
Microarray analysis in B cells among siblings with/without MS - role for transcription factor TCF2.
Avasarala JR
BMC Medical Genomics, 1:2 (2008)
Haixin Guo et al.
Analytical and bioanalytical chemistry, 413(1), 235-244 (2020-10-14)
A portable photothermal immunoassay based on Au-coated magnetic Fe3O4 core-shell nanohybrids (Au-Fe3O4) was developed for point-of-care (POC) testing of lipoprotein-associated phospholipase A2 (Lp-PLA2) on a digital near-infrared (NIR) thermometer. Au-Fe3O4 photothermal materials were first synthesized through reverse micelle method, and

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.