HPA039281

Anti-DIS3 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Dis3 mitotic control homolog (S. cerevisiae), Anti-Dis3p, Anti-Exosc11, Anti-Exosome complex exonuclease RRP44, Anti-Kiaa1008, Anti-Rrp44
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA039281
• NACRES: NA.43

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: RNAi knockdown; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Sequenza immunogenica: EAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSN
• N° accesso UniProt: Q9Y2L1
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... DIS3(22894)

Descrizione

Descrizione generale

The DIS3 homolog, exosome endoribonuclease and 3′-5′ exoribonuclease (DIS3) gene, with 21 exons spanning 26.5kb of genomic DNA, is mapped to human chromosome 13q21-q22. The encoded protein is a human ortholog of yeast Dis3p. DIS3 belongs to the RNase II family and is composed of 958 amino acids. DIS3 is a catalytic subunit and is localized in the nucleus and cytoplasm. DIS3 contains a RNB domain involved in the exonucleolytic activity and an N-terminal PilT N-terminal (PIN) domain involved in the endonucleolytic activity.

Immunogeno

DIS3 exosome endoribonuclease and 3′-5′ exoribonuclease

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Azioni biochim/fisiol

DIS3 homolog, exosome endoribonuclease and 3′-5′ exoribonuclease (DIS3) has both active exonuclease and endonucleolytic activity. The encoded protein is involved in the direct processing, turnover and surveillance of a large number of distinct RNA species.Inactivation mutations of DIS3 is associated with relapsed acute myeloid leukemia (AML). In addition, mutation of hDIS3 PilT N terminus (PIN) domain is also associated with the development of multiple myeloma (MM). Therefore, hDIS3 PIN domain can be considered as a potential target for the treatment of MM.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST81290

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable