HPA023370

Anti-PCM1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Sinonimo/i: Pcm1 Antibody, Pcm1 Antibody - Anti-PCM1 antibody produced in rabbit, Anti-PCM-1, Anti-Pericentriolar material 1 protein, Anti-hPCM-1
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA023370
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: independent; Learn more about Antibody Enhanced Validation
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:1000-1:2500
• Sequenza immunogenica: EEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKTQKDT
• N° accesso UniProt: Q15154
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PCM1(5108)

Descrizione

Descrizione generale

The gene PCM1 (pericentriolar material 1) is mapped to human chromosome 8p22. The encoded protein localizes to cytoplasmic granules known as ‘centriolar satellites′, which are present around the centrosome. It has a molar mass of 228kD protein.

Immunogeno

Pericentriolar material 1 protein recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-PCM1 antibody produced in rabbit has been used as a primary antibody in immunofluorescence. It has also been used for immunohistochemistry study and for flow cytometry and magnetic-assisted cell sorting assay.
All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

The gene PCM1 (pericentriolar material 1) encodes a large centrosomal protein with multiple coiled-coil domains that forms a complex with disrupted-in-schizophrenia 1 (DISC1) and Bardet-Biedl syndrome 4 protein (BBS4). This binding helps in synergistic targeting of PCM1 and other cargo proteins to the centrosome. It functions as a scaffold and facilitates the targeting of several proteins to the centrosome in a dynein motor-dependent manner and helps in regulating microtubular dynamics. The centriolar satellites that contain PCM1 protein participate in microtubule- and dynactin-dependent recruitment of proteins to the centrosome and mediate the assembly of centrosomal proteins and microtubule organization. Defects in this gene are associated with reduction in gray matter volume and susceptibility to schizophrenia.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76187

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1