Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

HPA008445

Sigma-Aldrich

Anti-YWHAE antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-14-3-3 protein epsilon, Anti-14-3-3E

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41
Coniugato:
unconjugated
application:
IHC
Clone:
polyclonal
Reattività contro le specie:
mouse, human, rat
citations:
4
tecniche:
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

mouse, human, rat

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

Sequenza immunogenica

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... YWHAE(7531)

Descrizione generale

Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein-ε (YWHAE) is one of the adaptor proteins that interacts with phosphorylated serine or threonine residue of target proteins. The gene encoding this protein is present on chromosome 17p13.

Immunogeno

14-3-3 protein epsilon recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-YWHAE antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-YWHAE antibody produced in rabbit can also be used for immunoprecipitation.

Azioni biochim/fisiol

Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein-ε (YWHAE) binds to cyclin-dependent kinase 5 (CDK5)-phosphorylated nudE neurodevelopment protein 1-like 1 (NUDEL) and maintains its phosphorylation state. NUDEL is a cytoplasmic regulator of neuronal migration. YWHAE is required for neuronal development as it aids in the transport of the NUDEL complex. It has protective and preventive effect on schizophrenia.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71114

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Assignment of the human 14-3-3 epsilon isoform (YWHAE) to human chromosome 17p13 by in situ hybridization.
S C Luk et al.
Cytogenetics and cell genetics, 78(2), 105-106 (1997-01-01)
Masashi Ikeda et al.
Human molecular genetics, 17(20), 3212-3222 (2008-07-29)
Schizophrenia is a complex mental disorder with a fairly high degree of heritability. Although the causes of schizophrenia remain unclear, it is now widely accepted that it is a neurodevelopmental and neurodegenerative disorder involving disconnectivity and disorder of the synapses.
Cheng-Han Lee et al.
Proceedings of the National Academy of Sciences of the United States of America, 109(3), 929-934 (2012-01-10)
14-3-3 proteins are ubiquitously expressed regulators of various cellular functions, including proliferation, metabolism, and differentiation, and altered 14-3-3 expression is associated with development and progression of cancer. We report a transforming 14-3-3 oncoprotein, which we identified through conventional cytogenetics and
Wen-Bin Ou et al.
Oncogenesis, 10(5), 37-37 (2021-05-06)
Endometrial stromal sarcoma (ESS) is the second most common subtype of uterine mesenchymal cancer, after leiomyosarcoma, and oncogenic fusion proteins are found in many ESS. Our previous studies demonstrated transforming properties and diagnostic relevance of the fusion oncoprotein YWHAE-NUTM2 in

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.