Passa al contenuto
Merck
Tutte le immagini(5)

Documenti fondamentali

HPA003239

Sigma-Aldrich

Anti-PCMT1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-L-Isoaspartyl protein carboxyl methyltransferase antibody produced in rabbit, Anti-PIMT antibody produced in rabbit, Anti-Protein L-isoaspartyl/D-aspartyl methyltransferase antibody produced in rabbit, Anti-Protein-β-aspartate methyltransferase antibody produced in rabbit, Anti-Protein-L-isoaspartate(D-aspartate) O-methyltransferase antibody produced in rabbit

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.43

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

rat, mouse, human

Convalida avanzata

RNAi knockdown
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Sequenza immunogenica

AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PCMT1(5110)

Descrizione generale

PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase) gene encodes a protein that belongs to type II class of protein carboxyl methyltransferase enzymes. This gene is mapped to human chromosome 6q24-25.

Immunogeno

Protein-L-isoaspartate(D-aspartate) O-methyltransferase recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-PCMT1 antibody produced in rabbit is suitable for use in proteome-wide epitope mapping covering all human proteins for on- and off-target binding analysis.
Anti-PCMT1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase) protein repairs modified proteins by catalyzing the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that are formed from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It negatively regulates p53, a tumour suppressor protein, and in turn downregulates p53-mediated transcription of target genes. It may serve as a therapeutic target for cancers. It protects neural cells from Bax-induced apoptosis and defects in this gene may cause spina bifida in infants. It activates integrin αv and mediates cell adhesion in various cancer cell lines. The protein negatively regulates β−amyloid peptide formation and plays a protective role in Alzheimer′s disease pathogenesis.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79907

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Feng Liang et al.
Scientific reports, 7(1), 9201-9201 (2017-08-25)
Neuronal apoptosis chiefly contributes to the cell loss following traumatic brain injury (TBI). CGP3466B is a compound related to the anti-Parkinsonism drug R-(-)-deprenyl. Previous studies have illuminated anti-apoptosis effects of CGP3466B in different cell lines, but the underlying mechanisms have
Jiyeon Ryu et al.
Acta pharmacologica Sinica, 32(9), 1165-1172 (2011-08-16)
Protein L-isoaspartyl O-methyltransferase (PIMT) regulates cell adhesion in various cancer cell lines through activation of integrin αv and the PI3K pathway. The epithelial mesenchymal transition (EMT) enables epithelial cells to acquire the characteristics of mesenchymal cells, and to allow them
Huizhi Zhao et al.
Gene, 505(2), 340-344 (2012-06-01)
Protein-L-isoaspartate (D-aspartate) O-methyltransferase 1 (PCMT1) gene encodes for the protein repair enzyme L-isoaspartate (D-aspartate) O-methyltransferase (PIMT), which is known to protect certain neural cells from Bax-induced apoptosis. Previous study has shown that PCMT1 polymorphisms rs4552 and rs4816 of infant are
Jae-Cheol Lee et al.
Nature communications, 3, 927-927 (2012-06-28)
Protein methylation plays important roles in most, if not all, cellular processes. Lysine and arginine methyltransferases are known to regulate the function of histones and non-histone proteins through the methylation of specific sites. However, the role of the carboxyl-methyltransferase protein
Ana M Wägner et al.
The review of diabetic studies : RDS, 5(4), 225-231 (2009-03-19)
Posttranslational protein modifications have been implicated in the development of autoimmunity. Protein L-isoaspartate (D-aspartate) O-methyltransferase (PIMT) repairs modified proteins and is encoded by PCMT1, located in a region linked to type 1 diabetes (T1D), namely IDDM5. To evaluate the association

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.