Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

AV54586

Sigma-Aldrich

Anti-ACADSB antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-2-MEBCAD, Anti-ACAD7, Anti-Acyl-coenzyme A dehydrogenase, short/branched chain, Anti-SBCAD

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

44 kDa

Reattività contro le specie

human, rat, mouse, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_001600

N° accesso UniProt

P45954

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ACADSB(36)

Immunogeno

Synthetic peptide directed towards the middle region of human ACADSB

Applicazioni

Anti-ACADSB antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Azioni biochim/fisiol

The protein encoded by ACADSB (Acyl-coenzyme A dehydrogenase, short/branched chain) gene belongs to acyl-CoA dehydrogenases (ACADs) family and is mapped on to chromosome 10 at 10q25-q26. It is a homotetramer with each monomer comprising of a non-covalently bound flavin adenine dinucleotide (FAD) molecule as a cofactor. It catalyzes the initial step of mitochondrial fatty acid β-oxidation for substrates with four and six carbons. ACADSB also catalyzes the third step of leucine and isoleucine/valine metabolism. Deficiency of the encoded protein increases 2-methylbutyrylglycine and 2-methylbutyrylcarnitine in blood and urine and results in catabolism of L-isoleucine.

Sequenza

Synthetic peptide located within the following region: GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

B Binzak et al.
Biochimica et biophysica acta, 1382(1), 137-142 (1998-03-21)
The acyl-CoA dehydrogenases (ACDs) are a family of related enzymes which catalyze the alpha,beta-dehydrogenation of acyl-CoA esters, transferring electrons to electron transferring flavoprotein. We have recently cloned and characterized the cDNA for human short/branched chain acyl-CoA dehydrogenase (SBCAD). Based on
Amy K Saenger et al.
Biochemistry, 44(49), 16043-16053 (2005-12-08)
Human short-chain acyl-CoA dehydrogenase (hSCAD) catalyzes the first matrix step in the mitochondrial beta-oxidation cycle for substrates with four and six carbons. Previous studies have shown that the act of substrate/product binding induces a large enzyme potential shift in acyl-CoA
K M Gibson et al.
Pediatric research, 47(6), 830-833 (2000-06-01)
An 4-mo-old male was found to have an isolated increase in 2-methylbutyrylglycine (2-MBG) and 2-methylbutyrylcamitine (2-MBC) in physiologic fluids. In vitro oxidation studies in cultured fibroblasts using 13C- and 14C-labeled branched chain amino acids indicated an isolated block in 2-methylbutyryl-CoA
P Deloukas et al.
Nature, 429(6990), 375-381 (2004-05-28)
The finished sequence of human chromosome 10 comprises a total of 131,666,441 base pairs. It represents 99.4% of the euchromatic DNA and includes one megabase of heterochromatic sequence within the pericentromeric region of the short and long arm of the

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.