AV54283
Anti-APOE antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-AD2, Anti-Apolipoprotein E, Anti-Apoprotein, Anti-MGC1571
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
34 kDa
Reattività contro le specie
human
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... APOE(348)
Descrizione generale
APOE gene encodes for Apolipoprotein E, a main apoprotein of the chylomicron. ApoE is a 299 amino acid containing plasma protein with a molecular weight of 34kDa. It is synthesized primarily in liver and is mapped on to chromosome 19 in a cluster with APOC1 and APOC2.
Immunogeno
Synthetic peptide directed towards the N terminal region of human APOE
Applicazioni
Anti-APOE antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Azioni biochim/fisiol
ApoE binds to its specific receptor and mediates the transport of lipid and cholesterol, ligands for the low-density lipoprotein (LDL) and very low density lipoprotein (VLDL) receptors, through the bloodstream. It is also involved in repair mechanism against tissue injury. For example, increased amounts of apolipoprotein E are present at peripheral nerve injury and regeneration site. Mutation in APOE gene leads to familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides results in impaired clearance of chylomicron and VLDL remnant.
Sequenza
Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
12 - Non Combustible Liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
W A Groenewegen et al.
Arteriosclerosis and thrombosis : a journal of vascular biology, 14(11), 1695-1704 (1994-11-01)
We identified the first insertion mutation that specifies an apolipoprotein (apo)B truncation, apoB-70.5, in a father and son with hypobetalipoproteinemia (total and low-density lipoprotein [LDL] cholesterol < 5th percentile, plasma apoB levels approximately one third of normal). The mutation is
R W Mahley
Science (New York, N.Y.), 240(4852), 622-630 (1988-04-29)
Apolipoprotein E is a plasma protein that serves as a ligand for low density lipoprotein receptors and, through its interaction with these receptors, participates in the transport of cholesterol and other lipids among various cells of the body. A mutant
María Solanas-Barca et al.
Atherosclerosis, 222(2), 449-455 (2012-04-07)
Rare mutations in the APOE gene, undetectable with the usual genotyping technique, are responsible for dominant familial dysbetalipoproteinemia (FD) and therefore could be easily misclassified as familial combined hyperlipidemia (FCHL). We aimed to identify APOE mutations associated with dominant combined
Y K Paik et al.
Proceedings of the National Academy of Sciences of the United States of America, 82(10), 3445-3449 (1985-05-01)
The gene for human apolipoprotein E (apo-E) was selected from a library of cloned genomic DNA by screening with a specific cDNA hybridization probe, and its structure was characterized. The complete nucleotide sequence of the gene as well as 856
Barbara Castella et al.
Nature communications, 8, 15663-15663 (2017-06-06)
Vγ9Vδ2 T cells are activated by phosphoantigens, such as isopentenyl pyrophosphate (IPP), which is generated in the mevalonate pathway of antigen-presenting cells. IPP is released in the extracellular microenvironment via unknown mechanisms. Here we show that the ATP-binding cassette transporter
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.