Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV53826

Sigma-Aldrich

Anti-LPIN1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-DKFZp781P1796, Anti-KIAA0188, Anti-Lipin 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

98 kDa

Reattività contro le specie

horse, human, mouse, rabbit, dog, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... LPIN1(23175)

Immunogeno

Synthetic peptide directed towards the N terminal region of human LPIN1

Applicazioni

Anti-LPIN1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Azioni biochim/fisiol

LPIN1 (lipin 1) encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the dephosphorylation of phosphatidic acid to form diacylglycerol. It is a transcriptional co-regulator that regulates lipid metabolism and adipogenesis (adipocyte maturation and maintenance) by modulating the C/EBPα (CCAAT/enhancer-binding protein α) and PPAR γ (peroxisome-proliferator-activated receptor γ) network. Lipin 1 also plays a pivotal role in controlling autophagy clearance by facilitating the maturation of autolysosomes via stimulation of protein kinase D (PKD)-Vps34 phosphatidylinositol 3-kinase signaling cascade.

Sequenza

Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Peixiang Zhang et al.
Cell metabolism, 20(2), 267-279 (2014-06-17)
LPIN1 encodes lipin-1, a phosphatidic acid phosphatase (PAP) enzyme that catalyzes the dephosphorylation of phosphatidic acid to form diacylglycerol. Homozygous LPIN1 gene mutations cause severe rhabdomyolysis, and heterozygous LPIN1 missense mutations may promote statin-induced myopathy. We demonstrate that lipin-1-related myopathy
Hee Eun Kim et al.
The Biochemical journal, 453(1), 49-60 (2013-05-01)
PPARγ (peroxisome-proliferator-activated receptor γ) is a master transcription factor involved in adipogenesis through regulating adipocyte-specific gene expression. Recently, lipin1 was found to act as a key factor for adipocyte maturation and maintenance by modulating the C/EBPα (CCAAT/enhancer-binding protein α) and

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.