AV47723

Anti-TBX15 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-T-box 15, Anti-TBX14
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Coniugato: unconjugated
• application: IHC; WB
• Clone: polyclonal
• Reattività contro le specie: rabbit, rat, human, bovine, horse, mouse, dog, guinea pig
• citations: 2
• tecniche: immunohistochemistry: suitable; western blot: suitable

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 55 kDa
• Reattività contro le specie: rabbit, rat, human, bovine, horse, mouse, dog, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_689593
• N° accesso UniProt: Q96SF7
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TBX15(6913)

Descrizione

Descrizione generale

TBX15 codes for T-box transcription factor that regulates embryonic development. TBX15 mutations have been linked to Cousin syndrome.
Rabbit anti-TBX15 antibody recognizes human, mouse, rat, and canine TBX15.

The previously assigned protein identifier Q5JT54 has been merged into Q96SF7. Full details can be found on the UniProt database.

Immunogeno

Synthetic peptide directed towards the C terminal region of human TBX15

Applicazioni

Rabbit anti-TBX15 antibody is suitable for western blot applications at a concentration of 1.25μg/ml and for IHC applications (using paraffin-embedded tissues) at 4-8μg/ml.

Azioni biochim/fisiol

TBX15 is a probable transcriptional regulator involved in developmental processes.

Sequenza

Synthetic peptide located within the following region: YGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMH

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable