AV43905
Anti-SLC20A1 antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-DKFZp686J2397, Anti-FLJ41426, Anti-GLVR1, Anti-Glvr-1, Anti-PIT1, Anti-PiT-1, Anti-Solute carrier family 20 (phosphate transporter), member 1
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
74 kDa
Reattività contro le specie
pig, dog, horse, bovine, human
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... SLC20A1(6574)
Categorie correlate
Descrizione generale
Sodium-dependent phosphate transporter 1 (SLC20A1) protein is an inorganic phosphate transporter and a sodium-phosphate symporter. It is expressed in the plasma membrane and belongs to the inorganic phosphate transporter family (PiT). Also called PIT1, it is an N-linked glycosylated protein with N and C termini placed in the extracellular region. It comprises 12 transmembrane domains. SLC20A1 gene is mapped to human chromosome 2q14.1.
Specificità
Anti-SLC20A1 polyclonal antibody reacts with canine and human solute carrier family 20 (phosphate transporter) member 1 proteins.
Immunogeno
Synthetic peptide directed towards the C terminal region of human SLC20A1
Applicazioni
Anti-SLC20A1 antibody produced in rabbit has been used in western blotting (1:1000).
Azioni biochim/fisiol
Sodium-dependent phosphate transporter 1 (SLC20A1) protein is a high-affinity sodium (Na+)-phosphate (Pi) co-transporter that imports inorganic phosphate (Pi). It serves as a receptor for gibbon ape leukemia virus (GALV), feline leukemia virus type B (FeLV-B), woolly monkey virus and 10A1 murine leukemia virus, making it crucial for viral entry. SLC20A1 is essential for urinary tract and urorectal development. Variants ofSLC20A1 gene are implicated in the pathophysiology of bladder exstrophy-epispadias complex (BEEC) and in cloacal exstrophy. It may also participate in normal growth and development of the liver. Elevated expression of SLC20A1 gene is correlated to the activation of the wingless (Wnt)/β-catenin signaling pathway in somatotroph adenomas. SLC20A1 protein may participate in tumor necrosis factor-induced apoptosis and regulate cell proliferation, erythroid and B cell differentiation.
Sequenza
Synthetic peptide located within the following region: LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Eugénie Koumakis et al.
Scientific reports, 9(1), 1808-1808 (2019-02-14)
PiT1/SLC20A1 is an inorganic phosphate transporter with additional functions including the regulation of TNFα-induced apoptosis, erythropoiesis, cell proliferation and insulin signaling. Recent data suggest a relationship between PiT1 and NF-κB-dependent inflammation: (i) Pit1 mRNA is up-regulated in the context of
Mengqi Chang et al.
Frontiers in endocrinology, 11, 596554-596554 (2021-02-13)
Pituitary adenomas (PAs) can be classified as non-secreting adenomas, somatotroph adenomas, corticotroph adenomas, lactotroph adenomas, and thyrotroph adenomas. Substantial advances have been made in our knowledge of the pathobiology of PAs. To obtain a comprehensive understanding of the molecular biological
Johanna Magdalena Rieke et al.
Frontiers in cell and developmental biology, 8, 567-567 (2020-08-28)
Previous studies in developing Xenopus and zebrafish reported that the phosphate transporter slc20a1a is expressed in pronephric kidneys. The recent identification of SLC20A1 as a monoallelic candidate gene for cloacal exstrophy further suggests its involvement in the urinary tract and
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.