AV40071

Anti-RNF8 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-FLJ12013, Anti-KIAA0646, Anti-Ring finger protein 8
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 55 kDa
• Reattività contro le specie: pig, mouse, bovine, rat, human, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_003949
• N° accesso UniProt: O76064
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... RNF8(9025)

Descrizione

Descrizione generale

Ring finger protein 8 (RNF8) is an E3 ubiquitin ligase which ubiquitinates proteins for degradation by proteosomes. RNF8 is involved in DNA double-strand break (DSB) repair, wherein RNF8 and RNF168 control the recruitment of 53BP1 to DNA damage sites and ubiquitination of histone-2A. RNF8 also mediates chromatin decondensation to create a local chromatin environment that is permissive to the assembly of checkpoint and repair machineries at DNA lesions.

Specificità

Anti-RNF8 polyclonal antibody reacts with human, mouse, rat, and bovine ring finger protein 8 proteins.

Immunogeno

Synthetic peptide directed towards the C terminal region of human RNF8

Applicazioni

Anti-RNF8 polyclonal antibody is used to tag ring finger protein 8 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles ring finger protein 8 in processes such as DNA double-strand break (DSB) repair.

Azioni biochim/fisiol

RNF8 contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins.The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Sequenza

Synthetic peptide located within the following region: MEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable