Passa al contenuto
Merck
Tutte le immagini(9)

Documenti

AMAB91130

Sigma-Aldrich

Monoclonal Anti-CHAT antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL3173, purified immunoglobulin, buffered aqueous glycerol solution

Sinonimo/i:

Anti-CHOACTASE, Anti-CMS1A, Anti-CMS1A2, Anti-CMS6

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.43

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

CL3173, monoclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Forma fisica

buffered aqueous glycerol solution

Reattività contro le specie

mouse, human, rat

Convalida avanzata

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunofluorescence: 2-10 μg/mg (Fixation/Permeabilization: PFA/Triton X-100)
immunohistochemistry: 1:1000- 1:2500

Isotipo

IgG2b

Sequenza immunogenica

GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CHAT(1103)

Descrizione generale

Choline O-acetyltransferase (CHAT) gene is mapped to human chromosome 10q11.23. It has a choline binding domain pocket and a catalytic domain.

Immunogeno

choline O-acetyltransferase

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Azioni biochim/fisiol

Choline O-acetyltransferase (CHAT) enzyme mediates the synthesis of neurotransmitter, acetylcholine from choline and acetyl-CoA in cholinergic neurons. Phosphorylation at serine and threonine residues is critical for the function of CHAT. Mutations in the active site residues, results in loss of enzyme activity. Deletion in CHAT gene locus impacts neuromuscular signal transmission contributing to muscle weakness in congenital myasthenic syndromes. A mutation in the CHAT gene leads to choline acetyltransferase deficiency and triggers recurrent breathlessness in infants. Polymorphisms in CHAT is implicated in Alzheimer′s disease.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74314

Stato fisico

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Functional consequences and structural interpretation of mutations of human choline acetyltransferase
Shen Xm, et al.
Human Mutation, 32(11), 1259-1267 (2011)
Human choline acetyltransferase gene maps to region 10q11-q22. 2 by in situ hybridization
Strauss WL, et al.
Genomics, 9(2), 396-398 (1991)
Functional regulation of choline acetyltransferase by phosphorylation
Dobransky T and Rylett RJ
Neurochemical Research, 28(3-4), 537-542 (2003)
Association of Choline Acetyltransferase Gene Polymorphisms (SNPs rs868750G/A, rs1880676G/A, rs2177369G/A and rs3810950G/A) with Alzheimer?s Disease Risk: A Meta-Analysis
Yuan H, et al.
PLoS ONE, 11(7), e0159022-e0159022 (2016)
Congenital myasthenic syndrome associated with episodic apnea and sudden infant death
Byring RF, et al.
Neuromuscular Disorders, 12(6), 548-553 (2002)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.