AV37583

Anti-E2F7 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-A630014C11Rik, Anti-D10Ertd739e, Anti-E2F transcription factor 7
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 99 kDa
• Reattività contro le specie: mouse, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_848724
• N° accesso UniProt: Q6S7F2
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: mouse ... E2f7(52679)

Descrizione

Descrizione generale

E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 7 (E2F7) which is highly expressed during mid to late S-phase binds to the promoter regions of and represses G(1)/S-regulated genes thus promoting the downswing of oscillating G(1)/S genes during S-phase progression.

The previously assigned protein identifier Q8BSQ3 has been merged into Q6S7F2. Full details can be found on the UniProt database.

Specificità

Anti-E2F7 polyclonal antibody reacts with human, rat, canine, bovine, and mouse E2F transcription factor 7 proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of mouse E2f7

Applicazioni

Anti-E2F7 polyclonal antibody is used to tag E2F transcription factor 7 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E2F transcription factor 7 in the regulation of cell proliferation, especially at the level of G(1)/S gene activity during S-phase progression.

Azioni biochim/fisiol

E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts

Sequenza

Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable