Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

AV36019

Sigma-Aldrich

Anti-EBF2 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-COE2, Anti-EBF-2, Anti-Early B-cell factor 2, Anti-FLJ11500, Anti-O/E-3, Anti-OE-3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

61 kDa

Reattività contro le specie

human, rat, rabbit, guinea pig, horse, mouse, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_073150

N° accesso UniProt

Q9HAK2

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... EBF2(64641)

Immunogeno

Synthetic peptide directed towards the C terminal region of human EBF2

Azioni biochim/fisiol

EBF2 belongs to the EBF/COE family of transcription factors that contain well-conserved DNA-binding domain. EBF factors play important regulatory roles in various developmental processes and in differentiation of osteoblasts. EBF2 is critical in the generation and migration of Cajal-Retzius neurons during early cortical neurogenesis in cerebral cortex.

Sequenza

Synthetic peptide located within the following region: VPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Francesca Chiara et al.
Developmental biology, 365(1), 277-289 (2012-03-17)
Cajal-Retzius (CR) cells play a crucial role in the formation of the cerebral cortex, yet the molecules that control their development are largely unknown. Here, we show that Ebf transcription factors are expressed in forebrain signalling centres-the septum, cortical hem
Shu-Mien Chuang et al.
Developmental neuroscience, 33(6), 479-493 (2011-11-02)
Mammalian cortical neurogenesis occurs on a precise time schedule during development. The earliest born neurons form the preplate and later separate into layer 1, which includes Cajal-Retzius (C-R) neurons, and the subplate. The preplate and its derivatives play a critical
S S Wang et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 17(11), 4149-4158 (1997-06-01)
The Olf-1/EBF helix-loop-helix (HLH) transcription factor has been implicated in olfactory gene regulation and in B-cell development. Using homology screening methods, we identified two additional Olf-1/EBF-like cDNAs from a mouse embryonic cDNA library. The Olf-1/EBF-like (O/E) proteins O/E-1, O/E-2, and
Ana Patiño-García et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 15(16), 5082-5091 (2009-08-13)
Osteosarcoma is the most prevalent bone tumor in children and adolescents. At present, the mechanisms of initiation, maintenance, and metastasis are poorly understood. The purpose of this study was to identify relevant molecular targets in the pathogenesis of osteosarcoma. Tumor

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.