AV35300

Anti-NMUR2 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Neuromedin U receptor 2
• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 46 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_064552
• N° accesso UniProt: Q9GZQ4
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... NMUR2(56923)

Descrizione

Descrizione generale

NMUR2 (neuromedin U receptor 2) belongs to the G-protein coupled receptor family. It is known to mediate anti-obesity effects by regulating food intake and body weight.
Rabbit Anti-NMUR2 antibody recognizes human NMUR2.

Immunogeno

Synthetic peptide directed towards the N terminal region of human NMUR2

Applicazioni

Rabbit Anti-NMUR2 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

Azioni biochim/fisiol

NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.

Sequenza

Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable