Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV34285

Sigma-Aldrich

Anti-CORO1A (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Coronin, actin binding protein, 1A

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

51 kDa

Reattività contro le specie

guinea pig, human, dog, bovine, rat, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_009005

N° accesso UniProt

Q2YD73

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CORO1A(11151)

Descrizione generale

CORO1A is a WD-repeat protein that has been implicated in Mycobacterium leprae infection. Studies have reported that CORO1A localizes on the membrane of phagosomes that contain M. leprae, where Toll-like receptor (TLR) 2 is also present. CORO1A suppresses TLR-mediated signaling in human macrophages.
Rabbit Anti-CORO1A recognizes bovine, rat, rabbit, mouse, human, and canine CORO1A.

Immunogeno

Synthetic peptide directed towards the C terminal region of human CORO1A

Applicazioni

Rabbit Anti-CORO1A can be used for western blot applications at a concentration of 1.25 μg/ml.

Azioni biochim/fisiol

CORO1A forms homodimers. It plays a role in the cross-linking of F-actin in the cell.

Sequenza

Synthetic peptide located within the following region: TGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC7731

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Koichi Suzuki et al.
Acta histochemica et cytochemica, 39(4), 107-112 (2007-03-01)
Mycobacteria have acquired an intracellular lifestyle within the macrophage, which is best exemplified by the enlarged infected histiocytes seen in lepromatous leprosy. To survive within the cell, mycobacteria must escape intracellular bactericidal mechanisms. In a study of Mycobacterium bovis Bacille
K Tanigawa et al.
Clinical and experimental immunology, 156(3), 495-501 (2009-05-15)
Mycobacterium leprae is an intracellular pathogen that survives within the phagosome of host macrophages. Several host factors are involved in producing tolerance, while others are responsible for killing the mycobacterium. Tryptophan aspartate-containing coat protein (TACO; also known as CORO1A or
M M-G Sun et al.
Osteoarthritis and cartilage, 22(7), 996-1006 (2014-05-24)
Activation of the Liver X Receptor (LXR) has recently been identified as a therapeutic strategy for osteoarthritis (OA). Human OA articular cartilage explants show decreased LXR expression, and LXRβ-null mice display OA-like symptoms. LXR agonist administration to OA articular cartilage
Zuoren Yu et al.
Oncotarget, 5(4), 1083-1090 (2014-03-25)
The serine threonine kinase Akt1 has been implicated in the control of cellular metabolism, survival and growth. Herein, disruption of the ubiquitously expressed member of the Akt family of genes, Akt1, in the mouse, demonstrates a requirement for Akt1 in

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.