Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

AV32841

Sigma-Aldrich

Anti-CHES1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Checkpoint suppressor 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

52 kDa

Reattività contro le specie

guinea pig, mouse, human, horse, rat, dog, rabbit

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_001078940

N° accesso UniProt

O00409

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CHES1(1112)

Descrizione generale

CHES1 (or FOXN3) is a forkhead transcription factor that modulates cell proliferation by supressing PIM2 and protein synthesis. FOXN3 has also been implicated in transcriptional repression, DNA damage responses, hematopoietic cancers, and oral cancers.
Rabbit Anti-CHES1 antibody recognizes chicken, zebrafish, human, mouse, rat, pig, and canine CHES1.

Immunogeno

Synthetic peptide directed towards the C terminal region of human CHES1

Applicazioni

Rabbit Anti-CHES1 antibody can be used for western blot applications at a concentration of 1.25μg/ml

Azioni biochim/fisiol

Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.

Sequenza

Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Yin-Ju Chen et al.
Head & neck, 33(2), 257-266 (2010-09-18)
This study was undertaken to identify the genes in response to areca nut extract, a potential carcinogen of oral cancer. Two oral cancer sublines chronically treated with areca nut extract were established. Methods such as microarray and immunohistochemistry were used
Kenneth L Scott et al.
Gene, 359, 119-126 (2005-08-17)
Checkpoint Suppressor 1 (CHES1; FOXN3) encodes a member of the forkhead/winged-helix transcription factor family. The human CHES1 cDNA was originally identified by its ability to function as a high-copy suppressor of multiple checkpoint mutants of Saccharomyces cerevisiae. Accumulating expression profile
Valeria Busygina et al.
Cancer research, 66(17), 8397-8403 (2006-09-05)
Multiple endocrine neoplasia type 1 (MEN1) is a cancer susceptibility syndrome affecting several endocrine tissues. Investigations of the biochemical function of the MEN1 protein, menin, have suggested a role as a transcriptional comodulator. The mechanism by which MEN1 inactivation leads

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.