Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV30002

Sigma-Aldrich

Anti-CBX4 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Chromobox homolog 4 (Pc class homolog, Drosophila)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

61 kDa

Reattività contro le specie

rat, guinea pig, bovine, rabbit, dog, human, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_003646

N° accesso UniProt

O00257-2

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CBX4(8535)

Immunogeno

Synthetic peptide directed towards the N terminal region of human CBX4

Applicazioni

Anti-CBX4 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Azioni biochim/fisiol

CBX4 belongs to the Polycomb group of proteins that are involved in determining stem cell pluripotency, identity and epigenetic gene silencing. CBX4 exhibits E3 sumo ligase activity that is directly involved in DNA damage response pathway. It interacts with p63 and regulates the transcription of genes that maintain the stemness of epithelial progenitors. CBX4 has a non-redundant role in T-cell proliferation and thymic organogenesis.

Sequenza

Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC1928

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Ismail Hassan Ismail et al.
Nucleic acids research, 40(12), 5497-5510 (2012-03-10)
Polycomb group (PcG) proteins are involved in epigenetic silencing where they function as major determinants of cell identity, stem cell pluripotency and the epigenetic gene silencing involved in cancer development. Recently numerous PcG proteins, including CBX4, have been shown to
Bo Liu et al.
Development (Cambridge, England), 140(4), 780-788 (2013-01-31)
Thymic epithelial cells (TECs) are the main component of the thymic stroma, which supports T-cell proliferation and repertoire selection. Here, we demonstrate that Cbx4, a Polycomb protein that is highly expressed in the thymic epithelium, has an essential and non-redundant

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.