AV03006
Anti-CDK2 antibody produced in rabbit
IgG fraction of antiserum
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
34 kDa
Reattività contro le specie
mouse, rabbit, sheep, human, bovine, goat, rat
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... CDK2(1017)
Categorie correlate
Immunogeno
Synthetic peptide directed towards the C terminal region of human CDK2
Applicazioni
Anti-CDK2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Azioni biochim/fisiol
Cyclin-dependent kinase 2 has a unique role in suppressing cell senescence and apoptosis induced by Myc. It is redundant for cell cycle progression but is activated following Myc overexpression to prevent Myc-induced senescence-like arrest. CDK2 functions in association with cyclin E and regulates meiosis at prophase I.
Sequenza
Synthetic peptide located within the following region: SKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Raccomandato
N° Catalogo
Descrizione
Determinazione del prezzo
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Stefano Campaner et al.
Cell cycle (Georgetown, Tex.), 9(18), 3655-3661 (2010-09-08)
The aberrant activation of oncogenic pathways promotes tumor progression, but concomitantly elicits compensatory tumor-suppressive responses, such as apoptosis or senescence. For example, Ras induces senescence, while Myc generally triggers apoptosis. Myc is in fact viewed as an anti-senescence oncogene, as
Per Hydbring et al.
Aging, 2(4), 244-250 (2010-05-07)
Proto-oncogenes such as MYC and RAS promote normal cell growth but fuel tumor development when deregulated. However, over-activated Myc and Ras also trigger intrinsic tumor suppressor mechanisms leading to apoptosis and senescence, respectively. When expressed together MYC and RAS are
Stefano Campaner et al.
Nature cell biology, 12(1), 54-59 (2009-12-17)
Activated oncogenes induce compensatory tumour-suppressive responses, such as cellular senescence or apoptosis, but the signals determining the main outcome remain to be fully understood. Here, we uncover a role for Cdk2 (cyclin-dependent kinase 2) in suppressing Myc-induced senescence. Short-term activation
Fu-Yao Liu et al.
Oncology reports, 32(2), 835-844 (2014-06-13)
Minocycline, a semisynthetic tetracycline, is a highly lipophilic molecule capable of infiltrating tissues and blood. Previous studies have revealed the functions and mechanisms of minocycline in anti-inflammation, protection of the nervous system and certain tumors. The role of minocycline has
Yang Yang et al.
Oncology reports, 31(6), 2759-2768 (2014-04-05)
A large quantity of M2-polarized tumor-associated macrophages (TAMs) is present in the tissue, ascitic fluid and peritoneum of ovarian cancer patients. A thorough understanding of the roles of M2-TAM in the development of ovarian cancer may provide new insight into
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.