AG549
α-synuclein 61-140, human
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
eCl@ss:
32160702
NACRES:
NA.77
Prodotti consigliati
Origine biologica
human
Livello qualitativo
Saggio
>95% (SDS-PAGE)
Stato
powder
PM
Mw 8,460 Da
Produttore/marchio commerciale
Chemicon®
tecniche
cell based assay: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
dry ice
Informazioni sul gene
human ... SNCA(6622)
Descrizione generale
Alpha-synuclein is encoded by the SNCA gene (also known as NACP, PARK1) in human. There are two other known synuclein family members, beta- and gamma-synuclein. Interest in synuclein research started with the discovery of alpha-synuclein mutation in several families with autosomal dominant Parkinson′s disease (PD). Alpha-synuclein is abundantly expressed in the brain and is found in a classic amyloid fibril form within the intra-neuronal Lewy body deposits of PD. The physiological function of synucleins is not well understood, but appears to involve membrane interactions, and in particular reversible binding to synaptic vesicle membranes. Contradictory evidences regarding inhibitory action of alpha-synuclein against phospholipase D (PLD) have been reported (PMID 11821392 & 19146388). Clone Syn211, Cat. No. 36-008-C detects epitope in the region from amino acid 121 to 125 and has been used together with clone LB509, Cat. No. MABN824, to characterize the digestion pattern of different forms of in vitro prepared alpha-synclulein aggregates (Guo, J.L., et al. 2013; PMID 23827677).
MEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEE-
GAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
An additional amino acid (Met) is attached at the N-terminus.
GAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
An additional amino acid (Met) is attached at the N-terminus.
Product Source: E. coli
Applicazioni
Research Category
Neuroscience
Neuroscience
Research Sub Category
Neurodegenerative Diseases
Neurodegenerative Diseases
Stato fisico
White lyophilized powder. Resuspend in sterile water at concentration of 1 mg/mL. This will give you a final of 20 mM Tris/HCI, pH 7.5, 100 mM NaCl.
Stoccaggio e stabilità
Maintain lyophilized material at -20°C for up to 12 months after date of receipt. After reconstitution maintain at -20°C to -70°C for up to 2 weeks in undiluted aliquots. Avoid freeze/thaw cycles to avoid aggregation.
Note legali
CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Codice della classe di stoccaggio
11 - Combustible Solids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.