HPA004899

Anti-BCL6 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-B-cell lymphoma 6 protein antibody produced in rabbit, Anti-BCL-5 antibody produced in rabbit, Anti-BCL-6 antibody produced in rabbit, Anti-LAZ-3 protein antibody produced in rabbit, Anti-Zinc finger and BTB domain-containing protein 27 antibody produced in rabbit, Anti-Zinc finger protein 51 antibody produced in rabbit
• Numéro MDL: MFCD01633044
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA004899
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Disponibilité: not available in USA
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Séquence immunogène: NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS
• Numéro d'accès UniProt: P41182
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... BCL6(604)

Description

Description générale

BCL6 (B-cell CLL/lymphoma 6) is a nuclear protein, belonging to the BTB/POZ (BR-C, ttk and bab/Pox virus and Zinc finger) domain family of transcription factors. This zinc finger transcription factor has a molecular mass of 95kDa.

Immunogène

B-cell lymphoma 6 protein recombinant protein epitope signature tag (PrEST)

Application

Anti-BCL6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Actions biochimiques/physiologiques

BCL6 (B-cell CLL/lymphoma 6) is mainly involved in the regulation of B lymphocyte development and growth. Bcl6 acts as a diagnostic marker to identify the level of severity of various diseases. It is predominantly expressed in human cancers such as lymphoid malignancy, breast cancer. In breast cancer, it is associated with the proliferation, anchorage-independent growth, migration, and invasion. It is involved in the BCL6 translocation of primary central nervous system lymphoma, which is further linked with apoptosis process. It is a prime gene in B-cell lymphomagenesis. It has been reported that BCL6 may have corealtion with the preeclampsia.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86935

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)