WH0008999M1

Monoclonal Anti-CDKL2 antibody produced in mouse

clone 1F6, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-KKIAMRE, Anti-P56, Anti-cyclin-dependent kinase-like 2 (CDC2-related kinase)
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1F6, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• GenBank-Hinterlegungsnummer: NM_003948
• UniProt-Hinterlegungsnummer: Q92772
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CDKL2(8999)

Beschreibung

Allgemeine Beschreibung

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus. (provided by RefSeq)

Immunogen

CDKL2 (NP_003939, 394 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LKDCSNVSVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)