SAB1409619

Monoclonal Anti-S100A7 antibody produced in mouse

clone 2A10, purified immunoglobulin, buffered aqueous solution

• Synonym(e): PSOR1, S100A7c
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2A10, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 36.85 kDa
• Speziesreaktivität: human
• Methode(n): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2bκ
• NCBI-Hinterlegungsnummer: BC034687
• UniProt-Hinterlegungsnummer: P31151
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... S100A7(6278)

Beschreibung

Allgemeine Beschreibung

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. (provided by RefSeq)

Immunogen

S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable