MSST0001
SILu™Prot APOA1, Apolipoprotein A-1 human
recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled
Synonyme(s) :
SILu™Prot Apolipoprotein A-1
About This Item
Produits recommandés
Source biologique
human
Niveau de qualité
Produit recombinant
expressed in HEK 293 cells
Étiquette/Marqueur
His tagged
V5 tagged
Essai
≥98% (SDS-PAGE)
Forme
lyophilized powder
Conditionnement
vial of ≥10 μg (Lot-specific vial content given on certificate of analysis)
Technique(s)
mass spectrometry (MS): suitable
Numéro d'accès UniProt
Température de stockage
−20°C
Informations sur le gène
human ... APOA1(335)
Catégories apparentées
Description générale
Application
Characterization of Heavy Recombinant Proteins for Use as Internal Standards in Quantitative MS Workflows
Characterization of stable isotope labeled APO-A1 for use as an internal standard in a quantitative MS workflow
Characterization of Clinically-Relevant Stable Isotope Labeled Recombinant Proteins for Use as Internal Standards in Quantitative MS Workflows
Forme physique
Notes préparatoires
Stockage et stabilité
Remarque sur l'analyse
SILu™Prot ApoA−Ι is a recombinant, stable isotope-labeled human Apo A1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of ApoA1 in mass-spectrometry. SILu Prot Apo A-Ι is a monomer of 280 amino acids (including C-terminal polyhistidine and V5 tags), with an apparent molecular weight of 32.3 kDa.
Sequence
RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLK
LLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKV
QPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEM
RDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEK
AKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQSDPSRGPFEGK
PIPNPLLGLDSTRTGHHHHHHHHGGQ
The N-terminal signal peptide and C-terminal linker peptide, V5 and polyhistidine tags are italicized. Suggested transitions for three peptides (bolded) are used for selected reaction monitoring analysis (SRM).
Label Incorporation
≥ 98% as determined by mass spectrometry
Other Characterization
- Sequence confirmed by intact mass analysis
- Identity verified by peptide mapping
- Purity >98% by SDS-PAGE
- Vial content was determined by the Bradford method using BSA as a calibrator. The correction factor of Bradford-to-AAA is 88.33%
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
Informations légales
Code de la classe de stockage
11 - Combustible Solids
Classe de danger pour l'eau (WGK)
WGK 2
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Faites votre choix parmi les versions les plus récentes :
Certificats d'analyse (COA)
Vous ne trouvez pas la bonne version ?
Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique