Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

AV46418

Sigma-Aldrich

Anti-TMPRSS11D antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-HAT, Anti-MGC150587, Anti-MGC150588, Anti-Transmembrane protease, serine 11D

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Conjugué:
unconjugated
application:
IHC
WB
Clone:
polyclonal
Espèces réactives:
human
citations:
3
Technique(s):
immunohistochemistry: suitable
western blot: suitable

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

46 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

Immunogène

Synthetic peptide directed towards the N terminal region of human TMPRSS11D

Application

Anti-TMPRSS11D antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

TMPRSS11D (transmembrane protease, serine 11D) gene also referred to as MGC150587, MGC150588 or HAT(human airway trypsin-like protease) encodes for a 418 amino acid containing type II integral membrane protein. HAT stimulates amphiregulin (AR) production via protease-activated receptor-2 (PAR-2) mediated ERK pathway and then releases it by TACE (tumor necrosis factor alpha-converting enzyme)-dependent mechanism. HAT also activates the PAR-2 and assists in regulating the cellular functions of human bronchial epithelial cells (HBEC). Additionally, it induces the fibroblast proliferation in bronchial airways by mediating the PAR-2-dependent MEK-MAPK pathway.

Séquence

Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Rie Matsushima et al.
American journal of physiology. Lung cellular and molecular physiology, 290(2), L385-L395 (2005-10-04)
Human airway trypsin-like protease (HAT) was isolated from airway secretions and localized to bronchial epithelial cells by immunohistochemistry. In the present study, we examined whether HAT could stimulate DNA synthesis and proliferation of primary human bronchial fibroblasts (HBF). HAT significantly
Manabu Chokki et al.
The FEBS journal, 272(24), 6387-6399 (2005-12-13)
Human airway trypsin-like protease (HAT), a serine protease found in the sputum of patients with chronic airway diseases, is an agonist of protease-activated receptor-2 (PAR-2). Previous results have shown that HAT enhances the release of amphiregulin (AR); further, it causes
Mari Miki et al.
The journal of medical investigation : JMI, 50(1-2), 95-107 (2003-03-13)
It has been shown that human airway trypsin-like protease (HAT) is localized in human bronchial epithelial cells (HBEC), and trypsin activates protease-activated receptor-2 (PAR-2). Activation of PAR-2 activates G-protein followed by an increase of intracellular free Ca2+, [Ca2+]in. This study
Jee Hyun Kim et al.
Yonsei medical journal, 55(5), 1333-1340 (2014-07-23)
The aim of this work was to evaluate nuclear histone acetylation level and total histone acetyltransferase (HAT) and deacetylase (HDAC) activity in ejaculated sperm and their relevance to conventional sperm parameters. Thirty-three normozoospermic men were included in this study. Semen
F Wang et al.
Neurological research, 36(3), 224-233 (2014-02-12)
The herbal extract 3-n-butylphthalide (NBP) is used in clinical practice for ischemic patients in China. It has been shown to have various neuroprotective effects both in vitro and in vivo. In the present study, the effects of NBP on learning

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique