Pular para o conteúdo
Merck
Todas as fotos(2)

Key Documents

WH0375611M4

Sigma-Aldrich

Monoclonal Anti-SLC26A5 antibody produced in mouse

clone 1F4, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-DFNB61, Anti-MGC118886, Anti-MGC118887, Anti-MGC118888, Anti-MGC118889, Anti-PRES, Anti-solute carrier family 26, member 5 (prestin)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

1F4, monoclonal

forma

buffered aqueous solution

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão GenBank

NM_198999

nº de adesão UniProt

P58743

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SLC26A5(375611)

Descrição geral

This gene is a member of the SLC26A/SulP transporter family. It encodes a protein that is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in this gene have been associated with non-syndromic hearing loss. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Imunogênio

SLC26A5 (NP_945350, 645 a.a. ~ 741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLREALAEQEASAPPSQEDLEPNATPAT

Ações bioquímicas/fisiológicas

Solute carrier family 26 member 5 (SLC26A5) functions as a transporter. Conformational changes in SLC26A5 leads to a change in the length of cochlear outer hair cells (OHC), which have a role in auditory perception.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

nwg

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Shumin Bian et al.
PloS one, 8(6), e66078-e66078 (2013-06-14)
Prestin (SLC26a5) is the outer hair cell integral membrane motor protein that drives cochlear amplification, and has been described as an obligate tetramer. We studied in real time the delivery of YFP-prestin to the plasma membrane of cells from a
Richard Sherva et al.
BMC medical genetics, 11, 51-51 (2010-04-01)
Patients with Hb E/beta0 thalassemia display remarkable variability in disease severity. To identify genetic modifiers influencing disease severity, we conducted a two-stage genome scan in groups of 207 mild and 305 severe unrelated patients from Thailand with Hb E/beta0 thalassemia
Seth L Alper et al.
Molecular aspects of medicine, 34(2-3), 494-515 (2013-03-20)
The phylogenetically ancient SLC26 gene family encodes multifunctional anion exchangers and anion channels transporting a broad range of substrates, including Cl(-), HCO3(-), sulfate, oxalate, I(-), and formate. SLC26 polypeptides are characterized by N-terminal cytoplasmic domains, 10-14 hydrophobic transmembrane spans, and
Jacob Pearson Keller et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(4), 1325-1332 (2014-01-24)
The solute carrier gene family 26 (SLC26) encodes membrane proteins with diverse physiological roles but with the common feature of halide involvement. Here, we present bioinformatic and biochemical evidence that SLC26 proteins have intrinsically disordered regions (IDRs) in their C-terminal

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica