Pular para o conteúdo
Merck
Todas as fotos(5)

Documentos Principais

WH0165918M1

Sigma-Aldrich

Monoclonal Anti-RNF168 antibody produced in mouse

clone 3E1, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-FLJ35794, Anti-ring finger protein 168

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(5)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

3E1, monoclonal

forma

buffered aqueous solution

reatividade de espécies

human, mouse, rat

técnica(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2bκ

nº de adesão GenBank

NM_152617

nº de adesão UniProt

Q8IYW5

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... RNF168(165918)

Descrição geral

The complex repair response elicited by DNA double-strand breaks (DSBs) includes recruitment of several DNA repair proteins and ubiquitination of H2A-type histones (see MIM 142720). RNF168 is an E3 ubiquitin ligase critical for DSB repair (Stewart et al., 2009 [PubMed 19203578]).[supplied by OMIM

Imunogênio

RNF168 (NP_689830, 462 a.a. ~ 571 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVPNRQKGSPDEYHLRATSSPPDKVLNGQRKNPKDGNFKRQTHTKHPTPERGSRDKNRQVSLKMQLKQSVNRRKMPNSTRDHCKVSKSAHSLQPSISQKSVFQMFQRCTK

Ações bioquímicas/fisiológicas

Ring finger protein 168 (RNF168) associates with ubiquitinated histone H2A. It has an important role in the ubiquitination pathway and binds to the conjugated ubiquitin on damaged chromosomes.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

nwg

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Marco Gatti et al.
Cell reports, 10(2), 226-238 (2015-01-13)
Ubiquitination regulates numerous cellular processes by generating a versatile communication system based on eight structurally and functionally different chains linked through distinct residues. Except for K48 and K63, the biological relevance of different linkages is largely unclear. Here, we show
Carsten Doil et al.
Cell, 136(3), 435-446 (2009-02-11)
DNA double-strand breaks (DSBs) not only interrupt the genetic information, but also disrupt the chromatin structure, and both impairments require repair mechanisms to ensure genome integrity. We showed previously that RNF8-mediated chromatin ubiquitylation protects genome integrity by promoting the accumulation
Changzheng Du et al.
Cell reports, 28(12), 3199-3211 (2019-09-19)
H2AX safeguards genomic stability in a dose-dependent manner; however, mechanisms governing its proteostasis are poorly understood. Here, we identify a PRMT5-RNF168-SMURF2 cascade that regulates H2AX proteostasis. We show that PRMT5 sustains the expression of RNF168, an E3 ubiquitin ligase essential

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica