Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

WH0149233M1

Sigma-Aldrich

Monoclonal Anti-IL23R antibody produced in mouse

clone 3D7, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-interleukin 23 receptor

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

3D7, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... IL23R(149233)

Descrição geral

Interleukin 23 receptor (IL23R) gene codes for a subunit of the IL-23 receptor. The gene is mapped to human chromosome 1p31.3.

Imunogênio

IL23R (NP_653302, 553 a.a. ~ 628 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLE

Ações bioquímicas/fisiológicas

Interleukin 23 receptor (IL23R) IL-12Rβ1 and forms IL-23 complex, which is essential for IL-23 signaling. It constitutively combines with Janus kinase 2 (JAK2). IL23R attaches to transcription activator signal transducer and activator of transcription 3 (STAT3) in a ligand-dependent manner and has a proinflammatory function. IL23R gene defends against Crohn′s disease.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

nwg

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Anthony W Segal
European journal of clinical investigation, 48 Suppl 2, e12983-e12983 (2018-06-23)
Crohn's disease (CD) is caused by a trigger, almost certainly enteric infection by one of a multitude of organisms that allows faeces access to the tissues, at which stage the response of individuals predisposed to CD is abnormal. In CD
Joerg Ermann et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(25), E2559-E2566 (2014-06-14)
T-bet(-/-).Rag2(-/-) (TRUC) mice spontaneously develop microbiota-driven, TNF-mediated large bowel inflammation that resembles human ulcerative colitis. We show here that IL-23 and IL-1-dependent secretion of IL-17A by innate lymphoid cells (ILCs; defined as CD45(+)lin(-)Thy1(hi)NKp46(-)) is a second critical pathway in this

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica