WH0055507M1

Monoclonal Anti-GPRC5D antibody produced in mouse

clone 6D9, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-G protein-coupled receptor, family C, group 5, member D
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 6D9, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• nº de adesão GenBank: NM_018654
• nº de adesão UniProt: Q9NZD1
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... GPRC5D(55507)

Descrição

Descrição geral

G protein-coupled receptor 5D (GPRC5D), a surface receptor consists of seven putative transmembrane segments. It is expressed in the cell membrane. This protein belongs to the retinoic acid inducible gene 1 or retinoic acid inducible GPCR 1 (RAIG1) family. GPRC5D is located on human chromosome 12p13.

Imunogênio

GPRC5D (NP_061124, 261 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV

Ações bioquímicas/fisiológicas

G protein-coupled receptor 5D (GPRC5D) considered as an important marker for monitoring the tumor load and also to target multiple myeloma cells. Overexpression of GPRC5D affects the expression of hard keratins and also decrease the metabolic activities of hair bulb cells (HBCs).

Características e benefícios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)