Pular para o conteúdo
Merck
Todas as fotos(7)

Documentos Principais

WH0006662M2

Sigma-Aldrich

Monoclonal Anti-SOX9 antibody produced in mouse

clone 3C10, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-CMD1, Anti-CMPD1, Anti-SRA1, Anti-SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

3C10, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SOX9(6662)

Descrição geral

The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. (provided by RefSeq)

Imunogênio

SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP

Aplicação

Monoclonal Anti-SOX9 antibody produced in mouse has been used in immunofluorescence.

Ações bioquímicas/fisiológicas

Sex determining region Y-box 9 (SOX9), a transcription factor, is associated with the testis-determining factor sex determining region Y (SRY). It is expressed mainly in adult tissues and also in fetal testis and skeletal tissue. SOX9 consists of two functional domains: a high-mobility group (HMG) DNA-binding domain and a C-terminal transactivation domain. It plays a major role in cartilage differentiation and early testis development. It has been reported that SOX9 might play a role in chondrogenesis. Mutation of SOX9 gene in human causes campomelic dysplasia, a severe dwarfism syndrome and autosomal XY sex reversal.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Sox9-Positive Progenitor Cells Play a Key Role in Renal Tubule Epithelial Regeneration in Mice
Hyun MiKang
Cell Reports (2016)
Daniel H Miller et al.
Stem cell reports, 10(3), 1131-1145 (2018-03-06)
The epithelial compartment of the mammary gland contains basal and luminal cell lineages, as well as stem and progenitor cells that reside upstream in the differentiation hierarchy. Stem and progenitor cell differentiation is regulated to maintain adult tissue and mediate
Loss of DNA-dependent dimerization of the transcription factor SOX9 as a cause for campomelic dysplasia
Elisabeth Sock
Human Molecular Genetics, 12 (2003)
Autosomal sex reversal and campomelic dysplasia are caused by mutations in and around the SRY-related gene SOX9
T Wagner
Cell, 79 (1994)
Toward understanding SOX9 function in chondrocyte differentiation. V Lefebvre and B de Crombrugghe Matrix biology : journal of the International Society for Matrix Biology
V Lefebvre
INTERNATIONAL CONFERENCE ON MATHEMATICS, ENGINEERING AND INDUSTRIAL APPLICATIONS 2014 (ICoMEIA 2014), 16 (1998)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica