WH0004760M1

Monoclonal Anti-NEUROD1 antibody produced in mouse

clone 3H8, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-BETA2, Anti-BHF1, Anti-NEUROD, Anti-neurogenic differentiation 1
• Número MDL: MFCD03097085
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3H8, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: BC009046
• nº de adesão UniProt: Q13562
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... NEUROD1(4760)

Descrição

Descrição geral

Neuronal differentiation 1 (NeuroD1) belongs to the family of a basic helix-loop-helix transcription factor. The NEUROD1 gene is localized on human chromosome 2q31.3 and is expressed in developing neurons.

Imunogênio

NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT

Ações bioquímicas/fisiológicas

Neuronal differentiation 1 (NeuroD1) may mediate the genesis of functional neurons from glial cells. Its higher expression favors neural differentiation in elder rats. NeuroD1 may be crucial for reversing functional impairment by favoring axonal regeneration in nerve injury. Various mutations in NEUROD1 reported have direct implications in the pathophysiology of early-onset diabetes, retinal dystrophy, nonsyndromic retinitis pigmentosa, and neurological abnormalities.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)