WH0004288M1

Monoclonal Anti-MKI67 antibody produced in mouse

clone 7B8, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-KIA, Anti-Ki67
• Número MDL: MFCD00803547
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 7B8, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_002417
• nº de adesão UniProt: P46013
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MKI67(4288)

Descrição

Descrição geral

Ki-67 (antigen KI-67) has a gene size of 29,545 bp and it consists of 15 exons and 14 introns. It has a minus strand orientation. This gene is located on human chromosome 10q26.2.

This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. (provided by RefSeq)

Imunogênio

MKI67 (NP_002408, 3157 a.a. ~ 3256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Aplicação

Monoclonal Anti-MKI67 antibody has been used in immunohistochemistry (IHC).

Ações bioquímicas/fisiológicas

Ki-67 (antigen KI-67) protein acts as a cellular marker for proliferation. This protein plays a major role in the maintenance and regulation of the cell division cycle. Ki-67, a part of the mitotic chromosome periphery, function as a biological surfactant to maintain individual mitotic chromosomes dispersed in the cytoplasm after nuclear envelope disassembly.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)