WH0004004M1

Monoclonal Anti-LMO1 antibody produced in mouse

clone 4F7, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-LIM domain only 1 (rhombotin 1), Anti-RBTN1, Anti-RHOM1, Anti-TTG1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4F7, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_002315
• nº de adesão UniProt: P25800
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... LMO1(4004)

Descrição

Descrição geral

LMO1 enocdes a cysteine-rich, two LIM domain transcriptional regulator. It is mapped to an area of consistent chromosomal translocation in chromosome 11, disrupting it in T-cell leukemia, although more rarely than the related gene, LMO2 is disrupted. (provided by RefSeq)

Imunogênio

LMO1 (NP_002306, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA

Características e benefícios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)