Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

WH0001390M2

Sigma-Aldrich

Monoclonal Anti-CREM antibody produced in mouse

clone 3B5, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-ICER, Anti-MGC111110, Anti-MGC17881, Anti-MGC41893, Anti-cAMP responsive element modulator, Anti-hCREM2

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

3B5, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CREM(1390)

Descrição geral

This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. (provided by RefSeq)
cAMP responsive element modulator (CREM) is encoded by the gene mapped to human chromosome 10p11.21. The encoded protein has tissue specific expression and it belongs to the family of cAMP-responsive promoter element (CRE)-binding factors. CREM contains 3′-located bZIP DNA-binding domains (DBD), kinase-inducible domain (KID) and two glutamine-rich domains.

Imunogênio

CREM (NP_853549, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY

Ações bioquímicas/fisiológicas

In mice, cAMP responsive element modulator (CREM) plays a crucial role in spermatid development. CREM is an essential constituent of cAMP-mediated signal transduction, which links extracellular signals to gene regulation. The encoded protein facilitates physiological and developmental function within the hypothalamic-pituitary-gonadal axis. Elevated expression of the gene has been observed in hepatocellular carcinoma (HCC) patients.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Inducibility and negative autoregulation of CREM: An alternative promoter directs the expression of ICER, an early response repressor
Molina CA, et al.
Cell, 75, 875-886 (1993)
Adrenergic signals direct rhythmic expression of transcriptional represser CREM in the pineal gland
Stehle JH, et al.
Nature, 365, 314-320 (1993)
Specific genomic and transcriptomic aberrations in tumors induced by partial hepatectomy of a chronically inflamed murine liver
Ella E, et al.
Oncotarget, 5, 10318-10331 (2014)
CREM activator and repressor isoforms in human testis: sequence variations and inaccurate splicing during impaired spermatogenesis
Behr R and Weinbauer GF
Molecular Human Reproduction, 6, 967-972 (2000)

Global Trade Item Number

SKUGTIN
WH0001390M2-100UG4061831631890

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica