SAB5702089

Anti-hnRNP E1/PCBP1 Antibody, clone 7M1K0, Rabbit Monoclonal

• Sinônimo(s): PCBP1, HEL-S-85, HNRPE1, HNRPX, hnRNP-E1, hnRNP-X, poly(rC)-binding protein 1
• Código UNSPSC: 12352203
• NACRES: NA.46
• clone: 7M1K0, monoclonal
• application: WB
• reatividade de espécies: human, rat, rat
• técnica(s): western blot: 1:500 - 1:2000

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 7M1K0, monoclonal
• Formulário: liquid
• peso molecular: 40 kDa
• reatividade de espécies: human, rat, rat
• concentração: 0.5 mg/mL
• técnica(s): western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTL
• nº de adesão UniProt: Q15365
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PCBP1(5093)

Descrição

Descrição geral

This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human hnRNP E1/PCBP1 (Q15365).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1