SAB5702074

Anti-ErbB4/HER4 Antibody, clone 8E5D0, Rabbit Monoclonal

• Sinônimo(s): ALS19,HER4,p180erbB4,ERBB4,HER4/ErbB4
• Código UNSPSC: 12352203
• NACRES: NA.46

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 8E5D0, monoclonal
• forma: liquid
• peso molecular: 180 kDa
• reatividade de espécies: rat, mouse
• concentração: 0.25 mg/mL
• técnica(s): western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: DEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
• nº de adesão UniProt: Q15303
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ERBB4(2066)

Descrição

Descrição geral

This gene is a member of the Tyr protein kinase family and the epidermal growth factor receptor subfamily. It encodes a single-pass type I membrane protein with multiple cysteine rich domains, a transmembrane domain, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domain binding motif. The protein binds to and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 1200-1308 of human ErbB4/HER4 (Q15303).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1