SAB5702039

Anti-IL10 Antibody, clone 6U0G7, Rabbit Monoclonal

• Sinônimo(s): CSIF, GVHDS, IL-10, IL10A, TGIF
• Código UNSPSC: 12352203
• NACRES: NA.46
• clone: 6U0G7, monoclonal
• application: IF; WB
• reatividade de espécies: rat, human, rat
• técnica(s): immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 6U0G7, monoclonal
• Formulário: liquid
• peso molecular: 18 kDa
• reatividade de espécies: rat, human, rat
• concentração: 1.60mg/mL
• técnica(s): immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAEN
• nº de adesão UniProt: P22301
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... IL10(3586)

Descrição

Descrição geral

The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.[provided by RefSeq, May 2011]

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL10 (P22301).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB, IF/ICC

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1