SAB2108772

Anti-PAX2 antibody produced in rabbit biotin conjugated

affinity isolated antibody

• Sinônimo(s): CPT1-M, CPT1M, CPTI, KIAA1670, M-CPT1
• Código UNSPSC: 12352203
• NACRES: NA.45

Propriedades

• fonte biológica: rabbit
• conjugado: biotin conjugate
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 42 kDa
• reatividade da espécie (prevista por homologia): guinea pig, rat, horse, canine, mouse, rabbit, bovine, zebrafish, human
• concentração: 0.5 mg/mL
• nº de adesão NCBI: NM_000278
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PAX2(5076)

Descrição

Descrição geral

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.

Imunogênio

Synthetic peptide directed towards the middle region of Human PAX2

Sequência

Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR

forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable